CACNA1G Antibody Summary
| Immunogen |
Synthetic peptide directed towards the middle region of human CACNA1G (NP_938202). Peptide sequence VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CACNA1G
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
241 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Concentration |
LYOPH
|
| Purity |
Immunogen affinity purified
|
| Reconstitution Instructions |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CACNA1G Antibody
- calcium channel, voltage-dependent, T type, alpha 1G subunit
- cav3.1c
- KIAA1123
- voltage-dependent calcium channel alpha 1G subunit
- voltage-dependent T-type calcium channel subunit alpha-1G
- voltage-dependent, alpha 1G subunit
- voltage-dependent, T type, alpha-1G subunit