DEGS1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to DEGS1(degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)) The peptide sequence was selected from the N terminal of DEGS1 (NP_003667). Peptide sequence GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIM
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
DEGS1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against DEGS1 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for DEGS1 Antibody
- Cell migration-inducing gene 15 protein
- Degenerative spermatocyte homolog 1
- degenerative spermatocyte homolog 1, lipid desaturase (Drosophila)
- degenerative spermatocyte homolog, lipid desaturase (Drosophila)
- DEGS
- Des-1
- DES1degenerative spermatocyte homolog, lipid desaturase
- EC 1.14
- FADS7
- membrane fatty acid (lipid) desaturase
- Membrane lipid desaturase
- MGC5079
- migration-inducing gene 15 protein
- MLDdihydroceramide desaturase
- sphingolipid delta 4 desaturase
- sphingolipid delta(4)-desaturase DES1
Background
DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified.