Cytochrome P450 2D6 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CYP2D6(cytochrome P450, family 2, subfamily D, polypeptide 6) The peptide sequence was selected from the N terminal of CYP2D6.Peptide sequence RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CYP2D6
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Cytochrome P450 2D6 Antibody
- CPD6P450DB1
- CYP2D
- CYP2D7AP
- CYP2D7BP
- CYP2D7P2
- CYP2D8P2
- CYP2DL1
- CYPIID6
- cytochrome P450 2D6
- cytochrome P450, family 2, subfamily D, polypeptide 6
- cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2
- cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2
- cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising)
- cytochrome P450, subfamily IID (debrisoquine, sparteine, etc.
- cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising)
- cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)
- Cytochrome P450-DB1
- Debrisoquine 4-hydroxylase
- EC 1.14.14.1
- flavoprotein-linked monooxygenase
- -metabolizing)-like 1
- MGC120389
- MGC120390
- microsomal monooxygenase
- P450C2D
- P450-DB1
- polypeptide 6
- polypeptide 7 pseudogene 2
- polypeptide 8 pseudogene 2
- xenobiotic monooxygenase
Background
CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzymes substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.