Product: p-Phenylene diisothiocyanate
Magmas Antibody Summary
| Immunogen |
The immunogen for this antibody is Magmas – C-terminal region. Peptide sequence NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PAM16
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Magmas Antibody
- MAGMAS
- mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction
- Mitochondria-associated granulocyte macrophage CSF-signaling molecule
- mitochondrial import inner membrane translocase subunit TIM16
- presequence translocase-associated motor 16 homolog (S. cerevisiae)
- Presequence translocated-associated motor subunit PAM16
- Tim16
- TIMM16magmas-like protein
Background
PAM16 regulates ATP-dependent protein translocation into the mitochondrial matrix and inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.