UQCR10 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to UCRC(ubiquinol-cytochrome c reductase complex (7.2 kD)) The peptide sequence was selected from the middle region of UCRC. Peptide sequence LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK.
|
| Specificity |
This product is specific to Subunit or Isofrom: 9.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
UQCR10
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against UCRC and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for UQCR10 Antibody
- Complex III subunit 9
- Complex III subunit X
- cytochrome b-c1 complex subunit 9
- Cytochrome c1 non-heme 7 kDa protein
- cytochrome C1, nonheme 7kDa protein
- HSPC051
- HSPC151
- QCR9
- ubiquinol-cytochrome c reductase complex (7.2 kD)
- ubiquinol-cytochrome c reductase, complex III subunit X
- ubiquinol-cytochrome c reductase, complex III subunit X, 7.2kDa
- UCCR7.2
- UCRCUbiquinol-cytochrome c reductase complex 7.2 kDa protein
Background
UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM].