SV2A Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SV2A(synaptic vesicle glycoprotein 2A) The peptide sequence was selected from the middle region of SV2A. Peptide sequence LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SV2A
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against SV2A and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Theoretical MW |
83 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Concentration |
LYOPH
|
| Purity |
Immunogen affinity purified
|
| Reconstitution Instructions |
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SV2A Antibody
- KIAA0736
- KIAA0736SV2
- SV2
- SV2A
- synaptic vesicle glycoprotein 2A
Background
SV2A plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. It positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.