Product: Labetalol (hydrochloride)
SLC45A2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLC45A2(solute carrier family 45, member 2) The peptide sequence was selected from the middle region of SLC45A2. Peptide sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC45A2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SLC45A2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLC45A2 Antibody
- AIM-1
- AIM11A1
- MATPmembrane associated transporter
- Melanoma antigen AIM1
- membrane-associated transporter protein
- Protein AIM-1
- SHEP5
- Solute carrier family 45 member 2
- solute carrier family 45, member 2
- underwhite
Background
SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, B, encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.The protein encoded by this gene encodes a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, B, encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. Alternative splicing results in multiple transcript variants encoding different isoforms.