Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLF
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SULT1E1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against SULT1E1 and was validated on Western blot. Immunohistochemistry-Paraffin was reported in scientific literature.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody
- Cytosolic Sulfotransferase 1E1
- EC 2.8.2
- EST-1
- ESTMGC34459
- estrone sulfotransferase
- ST1E1
- STE
- STEestrogen sulfotransferase
- Sulfotransferase 1E1
- sulfotransferase family 1E, estrogen-preferring, member 1
- Sulfotransferase, estrogen-preferringEC 2.8.2.4
- SULT1E1
Background
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.