Product: Apomorphine (hydrochloride hemihydrate)
HERC5 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HERC5(hect domain and RLD 5) The peptide sequence was selected from the middle region of HERC5.Peptide sequence FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTL.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HERC5
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against HERC5 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HERC5 Antibody
- CEB1E3 ISG15–protein ligase HERC5
- CEBP1
- cyclin-E binding protein 1
- Cyclin-E-binding protein 1
- EC 6.3.2
- EC 6.3.2.-
- HECT domain and RCC1-like domain-containing protein 5
- hect domain and RLD 5
- HECT E3 ubiquitin ligase
- probable E3 ubiquitin-protein ligase HERC5
Background
HERC5 is a member of the HERC family of ubiquitin ligases.It contains a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulates expression of HERC5 protein in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets.This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.