Product: D-Pantothenic acid (hemicalcium salt)
SIK1/Snf1lk Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SNF1LK(SNF1-like kinase) The peptide sequence was selected from the N terminal of SNF1LK.Peptide sequence MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SIK1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SNF1LK and was validated on Western Blot and immunohistochemistry-P
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SIK1/Snf1lk Antibody
- EC 2.7.11
- EC 2.7.11.1
- msk
- myocardial SNF1-like kinase
- salt-inducible kinase 1
- Salt-inducible protein kinase 1
- serine/threonine protein kinase
- serine/threonine-protein kinase SIK1
- Serine/threonine-protein kinase SNF1-like kinase 1
- Serine/threonine-protein kinase SNF1LK
- SIK
- SIK-1
- SNF1-like kinase
- SNF1LKMSK
Background
SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.