IGSF1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to IGSF1(immunoglobulin superfamily, member 1) The peptide sequence was selected from the N terminal of IGSF1 (NP_991402).Peptide sequence LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR.
|
| Specificity |
Appears to be specific to isoform 4
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
IGSF1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for IGSF1 Antibody
- CHTE
- IGCD1
- IGDC1
- IGDC1Pituitary gland-specific factor 2
- IGSF1
- immunoglobulin superfamily member 1
- immunoglobulin superfamily, member 1
- Immunoglobulin-like domain-containing protein 1
- InhBP
- Inhibin-binding protein
- KIAA0364p120
- MGC75490
- p120
- PGSF2
- PGSF2IGCD1
Background
Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM].