Connexin 32/GJB1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to GJB1 (gap junction protein, beta 1, 32kDa) The peptide sequence was selected from the C terminal of GJB1.Peptide sequence GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
GJB1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against GJB1 and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Connexin 32/GJB1 Antibody
- CMTX
- CMTX1
- Connexin 32
- Connexin-32
- CX32
- CX32beta 1, 32kD (connexin 32, Charcot-Marie-Toothneuropathy, X-linked)
- gap junction beta-1 protein
- gap junction protein, beta 1, 32kDa (connexin 32)
- gap junction protein, beta 1, 32kDa (connexin 32, Charcot-Marie-Toothneuropathy, X-linked)
- gap junction protein, beta 1, 32kDa
- GJB1
Background
This gene encodes for a Connexin 32 protein. A large Charcot-Marie-Tooth disease family has been identified with a novel mutation in the Cx32 P2 promoter region at position -526bp. Cx32 mutants that are associated with a CNS phenotype may have toxic effects in oligodendrocytes.