Carbohydrate Sulfotransferase 15/CHST15 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to GALNAC4S-6ST(B cell RAG associated protein) The peptide sequence was selected from the middle region of GALNAC4S-6ST.Peptide sequence YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CHST15
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against GALNAC4S-6ST and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Carbohydrate Sulfotransferase 15/CHST15 Antibody
- B cell RAG associated protein (GALNAC4S-6ST)
- B-cell RAG-associated gene protein
- BRAG
- BRAGKIAA0598RP11-47G11.1
- carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15
- Carbohydrate Sulfotransferase 15
- CHST15
- DKFZp781H1369
- EC 2.8.2.33
- GALNAC4S6ST
- GalNAc4S-6ST
- hBRAG
- MGC34346
- N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase
Background
GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3-phosphoadenosine 5-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.