TAK1L Antibody Summary
| Immunogen |
Synthetic peptides corresponding to TAK1L The peptide sequence was selected from the C terminal of TAK1L.Peptide sequence DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
C21ORF7
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against TAK1L and was validated on Western Blot and immunohistochemistry-p
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TAK1L Antibody
- chromosome 21 open reading frame 7
- HC21ORF7
- putative gene, TGF-beta-activated kinase like10TAK1LTAK1-like protein
- TAK1-like protein 1
- TAK1-like protein 2
- TAK1-like protein 4
- TAKL
- TAKL-1
- TAKL-2
- TAKL-4
- TGF-beta activated kinase
Background
TAK1L or C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.