Product: Cetylpyridinium (chloride monohydrate)
Claudin-17 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to CLDN17 (claudin 17) The peptide sequence was selected from the middle region of CLDN17.Peptide sequence KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CLDN17
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against CLDN17 and was validated on Western Blot and immunohistochemistry-paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Claudin-17 Antibody
- claudin 17
- Claudin17
- Claudin-17
- CLDN17
- human CLDN17 gene for claudin-17, 10claudin-17
- MGC126552
- MGC126554
Background
CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.