RAE1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to RAE1 (RAE1 RNA export 1 homolog (S. pombe)) The peptide sequence was selected from the C terminal of RAE1.Peptide sequence EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
RAE1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against RAE1 and was validated on Western Blot and immunohistochemistry-p
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for RAE1 Antibody
- dJ481F12.3
- dJ800J21.1
- FLJ30608
- homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer)
- MGC117333
- MGC126076
- MGC126077
- MIG14
- migration-inducing gene 14
- Mnrp41
- mRNA export factor
- mRNA export protein
- mRNA-associated protein mrnp 41
- mRNA-binding protein, 41-kD
- MRNP41
- RAE1 (RNA export 1, S.pombe) homolog
- Rae1 protein homolog
- RAE1 RNA export 1 homolog (S. pombe)
Background
RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene.