Recombinant Human Recoverin Protein Summary
| Description |
A recombinant protein corresponding to RCVRN.
Amino Acid Sequence: MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA |
| Preparation Method |
E.coli
|
| Protein/Peptide Type |
Recombinant Protein
|
| Gene |
RCVRN
|
| Purity |
>95% pure by SDS-PAGE
|
Applications/Dilutions
| Theoretical MW |
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
20 mM Tris pH 8.0, 1 mM EDTA, 2mM MgCl2, 10% glycerol
|
| Preservative |
No Preservative
|
| Concentration |
1.0 mg/ml
|
| Purity |
>95% pure by SDS-PAGE
|
Notes
The purity of this protein is > 95% by SDS-PAGE. Molecular weight is 23 kDa (200 aa), confirmed by MALDI-TOF.
Alternate Names for Recombinant Human Recoverin Protein
- cancer associated retinopathy antigen
- Protein CAR
- RCV1Cancer-associated retinopathy protein
- recoverin
Background
Recoverin is a heterogeneously acylated calcium-binding and intracellular signal transduction protein in the photoreceptor cells of retina. Recoverin contains four EF-hands, of which two bind Ca. Ca-induced extrusion of the acyl group from a hydrophobic cleft in the protein drives the translocation of recoverin from solution to the disc membrane. Recently, recoverin is a detectable serologic protein that is expressed in patients with cancer-associated retinopathy, a paraneoplastic syndrome. Recombinant human recoverin was overexpressed in E. coli and purified by using conventional chromatography techniques