c-Abl Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:TEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSP
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ABL1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for c-Abl Antibody
- Abelson murine leukemia viral oncogene homolog 1
- ABL
- ABL1
- bcr/abl
- BCR-ABL1
- c-abl oncogene 1, non-receptor tyrosine kinase
- c-abl oncogene 1, receptor tyrosine kinase
- cAbl
- c-Abl
- EC 2.7.10
- EC 2.7.10.2
- JTK7
- JTK7bcr/abl
- p150bcr/c-abl oncogene protein
- Proto-oncogene c-Abl
- proto-oncogene tyrosine-protein kinase ABL1
- tyrosine-protein kinase ABL1
- v-abl Abelson murine leukemia viral oncogene homolog 1
- v-abl