PUF60 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids:AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTL
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PUF60
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for PUF60 Antibody
- FBP interacting repressor
- FBP-interacting repressor
- FIRpoly-U binding splicing factor PUF60
- FLJ31379
- FUSE-binding protein-interacting repressor
- poly(U)-binding-splicing factor PUF60
- poly-U binding splicing factor 60KDa
- Ro ribonucleoprotein binding protein 1
- Ro ribonucleoprotein-binding protein 1
- Ro-binding protein 1
- roBP1
- RoBPI
- siah binding protein 1,60 kDa poly(U)-binding-splicing factor
- Siah-binding protein 1
- siah-BP1
- SIAHBP1pyrimidine tract binding splicing factor