ATP5A Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ATP5A1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for ATP5A Antibody
- ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1
- ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform1, cardiac muscle
- ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit, isoform2, non-cardiac muscle-like 2
- ATP sythase (F1-ATPase) alpha subunit
- ATP5AL2
- ATP5AMOM2
- ATPMATP synthase subunit alpha, mitochondrial
- cardiac muscle
- EC 3.6.3
- EC 3.6.3.14
- hATP1
- mitochondrial ATP synthetase, oligomycin-resistant
- OMR
- ORMATP synthase alpha chain, mitochondrial