DCI Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:FGSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRS
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
ECI1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Rat (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for DCI Antibody
- acetylene-allene isomerase
- D2-enoyl-CoA isomerase
- D3
- DCI3,2-trans-enoyl-CoA isomerase3,2 trans-enoyl-CoA isomerase
- Delta(2)-enoyl-CoA isomerase
- Delta(3)
- delta3, delta2-enoyl-CoA isomerase
- dodecenoyl-CoA delta isomerase (3,2 trans-enoyl-CoA isomerase)
- dodecenoyl-CoA isomerase3,2-trans-enoyl-CoA isomerase, mitochondrial
- dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase)
- EC 5.3.3.8
- enoyl-CoA delta isomerase 13,2 trans-enoyl-Coenzyme A isomerase