NAP1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TAB3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for NAP1 Antibody
- CG5330
- dNap
- dNap1
- dNAP-1
- MAP3K7IP3
- MGC45404
- mitogen-activated protein kinase kinase kinase 7 interacting protein 3
- Mitogen-activated protein kinase kinase kinase 7-interacting protein 3
- NAP1
- Nap-1
- NF-kappa-B-activating protein 1
- NFkB activating protein 1
- p56/dCAF-4
- TAB-3
- TAK1-binding protein 3
- TGF-beta activated kinase 1/MAP3K7 binding protein 3
- TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
- TGF-beta-activated kinase 1-binding protein 3