Product: Talabostat (mesylate)
Signal peptide peptidase-like 2B Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWAGSRDVKKRYMKHKRDDGPEKQEDEAVDV
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Predicted Species |
Mouse (94%). Backed by our 100% Guarantee.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
SPPL2B
|
Purity |
Affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Affinity purified
|
Alternate Names for Signal peptide peptidase-like 2B Antibody
- EC 3.4.23
- EC 3.4.23.-
- IMP-4
- IMP4MGC111084
- Intramembrane protease 4
- KIAA1532signal peptide peptidase-like 2B
- Presenilin-like protein 1
- PSL1
- SNPPL2B
- SPPL2b
- SPP-like 2B