Product: Milnacipran ((1S-cis) hydrochloride)
Cyr61/CCN1 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
CYR61
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
||
| Publications |
|
Reactivity Notes
Human reactivity reported in scientific literature (PMID: 26681917).
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for Cyr61/CCN1 Antibody
- CCN family member 1
- CCN1
- CCN1IGF-binding protein 10
- Cyr61
- Cysteine-rich angiogenic inducer 61
- cysteine-rich, angiogenic inducer, 61
- GIG1
- GIG1cysteine-rich heparin-binding protein 61
- IBP-10
- IGFBP-10
- IGFBP10cysteine-rich, anigogenic inducer, 61
- Insulin-like growth factor-binding protein 10
- protein CYR61
- Protein GIG1