Protein phosphatase 1 inhibitor 3D Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Predicted Species |
Mouse (91%). Backed by our 100% Guarantee.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PPP1R3D
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For HIER pH6 retrieval is recommended.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Rat (89%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for Protein phosphatase 1 inhibitor 3D Antibody
- DKFZp781L2441
- PP1 subunit R6
- PPP1R6
- protein phosphatase 1 regulatory subunit 3D
- protein phosphatase 1 regulatory subunit 6
- protein phosphatase 1, regulatory subunit 3D
- protein phosphatase 1, regulatory subunit 6, spinophilin
- protein phosphatase 1-binding subunit R6
- regulatory (inhibitor) subunit 3D