SLC20A2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLC20A2(solute carrier family 20 (phosphate transporter), member 2) The peptide sequence was selected from the N terminal of SLC20A2. Peptide sequence DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC20A2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against SLC20A2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Reactivity Notes
Porcine reactivity reported in scientific literature (PMID: 28111052).
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLC20A2 Antibody
- Gibbon ape leukemia virus receptor 2
- Glvr-2
- GLVR2PIT-2
- hPit2
- MLVAR
- murine leukemia virus, amphotropic, receptor for
- Phosphate transporter 2
- pit2
- PiT-2
- sodium-dependent phosphate transporter 2
- solute carrier family 20 (phosphate transporter), member 2
- Solute carrier family 20 member 2
Background
The function remains unknown.