HspA1L Antibody Summary
| Immunogen |
Synthetic peptides corresponding to HSPA1L(heat shock 70kDa protein 1-like) The peptide sequence was selected from the C terminal of HSPA1L (NP_005518).Peptide sequence DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
HSPA1L
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for HspA1L Antibody
- heat shock 10kDa protein 1-like
- Heat shock 70 kDa protein 1-Hom
- Heat shock 70 kDa protein 1L
- heat shock 70 kDa protein 1-like
- heat shock 70kD protein-like 1
- heat shock 70kDa protein 1-like
- HSP70-1L
- HSP70-HOM
- HSP70T
- hum70t
Background
HSPA1L is a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.