Product: Dapiprazole (hydrochloride)
GCLM Antibody Summary
| Immunogen |
Synthetic peptides corresponding to GCLM(glutamate-cysteine ligase, modifier subunit) The peptide sequence was selected from the middle region of GCLM.Peptide sequence KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
GCLM
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against GCLM and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for GCLM Antibody
- Gamma-ECS regulatory subunit
- Gamma-glutamylcysteine synthetase regulatory subunit
- GCS light chain
- GLCLRglutamate–cysteine ligase regulatory subunit
- glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory(30.8kD)
- Glutamate–cysteine ligase modifier subunit
- glutamate-cysteine ligase regulatory protein
- glutamate-cysteine ligase, modifier subunit
- GSC light chain
Background
Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.