UCH-L3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to UCHL3(ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)) The peptide sequence was selected from the N terminal of UCHL3.Peptide sequence MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPV
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
UCHL3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against UCHL3 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Theoretical MW |
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for UCH-L3 Antibody
- EC 3.4.19.12
- ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
- ubiquitin carboxyl-terminal hydrolase isozyme L3
- Ubiquitin Thioesterase L3
- ubiquitin thiolesterase
- UCHL3
- UCH-L3
Background
UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.