Product: SB 242086 (hydrochloride)
NIR2 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PITPNM1 (phosphatidylinositol transfer protein, membrane-associated 1) The peptide sequence was selected from the N terminal of PITPNM1. Peptide sequence PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSA
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PITPNM1
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against PITPNM1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
|
| Theoretical MW |
135 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
Reactivity Notes
Mouse reactivity reported in scientific literature (PMID: 27434059)
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for NIR2 Antibody
- DRES9NIR-2
- Drosophila retinal degeneration B homolog
- FLJ44997
- membrane-associated phosphatidylinositol transfer protein 1
- NIR2PITPNM
- phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2
- PITPnm 1
- Rd9
- RDGB
- RDGB1
- RDGBA
- RDGBA1
- retinal degeneration B alpha 1
Background
PITPNM1 belongs to a family of membrane-associated phosphatidylinositol transfer domain-containing proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein (Ocaka et al., 2005 [PubMed 15627748]).