Kv7.3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to the middle region of Kv7.3. Immunizing peptide sequence TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
KCNQ3
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
This is a rabbit polyclonal antibody against Kcnq3 and was validated on Western blot.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS & 2% Sucrose.
|
| Preservative |
No Preservative
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for Kv7.3 Antibody
- BFNC2
- EBN2
- KQT-like 3
- Kv7.3
- Potassium channel subunit alpha KvLQT3
- potassium channel, voltage-gated, subfamily Q, member 3
- potassium voltage-gated channel subfamily KQT member 3
- potassium voltage-gated channel, KQT-like subfamily, member 3
- Voltage-gated potassium channel subunit Kv7.3
Background
Kv7.3 is probably important in the regulation of neuronal excitability. It associates with KCNQ2 to form a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs.