Recombinant Human CD98 Protein Summary
| Description |
CD98 (Human) GST-Tagged Recombinant Protein
Source: Wheat Germ (in vitro) Amino Acid Sequence: IIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNY |
| Preparation Method |
in vitro wheat germ expression system
|
| Details of Functionality |
This protein is not active and should not be used for experiments requiring activity.
|
| Protein/Peptide Type |
Partial Recombinant Protein
|
| Gene |
SLC3A2
|
Applications/Dilutions
| Application Notes |
Useful in Western Blot and ELISA.Chromatin Immunoprecipitation was reported in scientific literature. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles.
|
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
|
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CD98 Protein
- 4F2
- 4F2hc
- 4T2HC
- antigen identified by monoclonal antibodies 4F2, TRA1.10, TROP4, and T43,4F2HC
- CD98 antigen
- CD98 heavy chain
- CD98
- CD98HC
- heavy chain
- Lymphocyte activation antigen 4F2 large subunit
- MDU1antigen defined by monoclonal 4F2, heavy chain
- monoclonal 44D7
- NACAE4F2 cell-surface antigen heavy chain
- SLC3A2
- solute carrier family 3 (activators of dibasic and neutral amino acidtransport), member 2,4F2 heavy chain antigen
Background
This gene is a member of the solute carrier family and encodes a cell surface, transmembrane protein with an alpha amylase domain. The protein exists as the heavy chain of a heterodimer, covalently bound through di-sulfide bonds to one of several possible light chains. It associates with integrins and mediates integrin-dependent signaling related to normal cell growth and tumorigenesis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]