POU3F2/OCT7 Antibody (6F6) Summary
| Immunogen |
POU3F2 (NP_005595, 1 a.a. – 67 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH
|
| Specificity |
POU3F2 – POU domain, class 3, transcription factor 2
|
| Isotype |
IgG2b Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
POU3F2
|
| Purity |
IgG purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
|
|
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
IgG purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for POU3F2/OCT7 Antibody (6F6)
- Brain-2
- Brain-specific homeobox/POU domain protein 2
- BRN2
- brn-2
- BRN2brain-2
- Nervous system-specific octamer-binding transcription factor N-Oct-3
- Oct7
- oct-7
- OCT7POU domain class 3, transcription factor 2
- Octamer-binding protein 7
- Octamer-binding transcription factor 7
- OTF7
- OTF-7
- POU class 3 homeobox 2
- POU domain, class 3, transcription factor 2
- POU3F2
- POUF3
Background
POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM]