Salivary Amylase Alpha Antibody (2D4) Summary
| Immunogen |
AMY1A (NP_001008222 172 a.a. – 245 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI
|
| Specificity |
AMY1A (2D4)
|
| Isotype |
IgG2a Kappa
|
| Clonality |
Monoclonal
|
| Host |
Mouse
|
| Gene |
AMY1A
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.4)
|
| Preservative |
No Preservative
|
| Purity |
Protein A purified
|
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Salivary Amylase Alpha Antibody (2D4)
- 1,4-alpha-D-glucan glucanohydrolase 1
- alpha-amylase 1
- AMY1
- AMY1B
- AMY1C
- amylase, alpha 1A (salivary)
- amylase, alpha 1A; salivary
- amylase, salivary, alpha-1A
- EC 3.2.1.1
- glycogenase
- Salivary alpha-amylase
- salivary amylase alpha 1A
Background
Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein.