IL-21 Antibody Summary
| Immunogen |
Synthetic peptide 78 CFQKAQLKSANTGNNERIINVSIKKLKRKPPS 109 corresponding to N-terminus region of human IL-21
|
| Specificity |
human IL-21
|
| Clonality |
Polyclonal
|
| Host |
Goat
|
| Gene |
IL21
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
10mM KHPO4 and 0.14M NaCl
|
| Preservative |
0.1% Sodium Azide
|
| Concentration |
1.0 mg/ml
|
| Purity |
Immunogen affinity purified
|
Alternate Names for IL-21 Antibody
- IL21
- IL-21
- IL-21Za11interleukin-21
- interleukin 21
- interleukin-21 isoform
Background
A novel cytokine related to IL2 and IL15 was recently identified and designated IL21. IL21 has been found to be a powerful growth factor for naive B cells. The receptor for IL21 (IL21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family. IL21R forms a complex with the common cytokine receptor g chain, gc, and mediates IL21 signaling. Both IL21R and the gc are necessary for the IL21 function. IL21 and its receptor activate JAKSTAT signaling pathway. IL21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL21 plays a role in the proliferation and maturation of NK, B and T cell populations.