ZPBP2 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQ
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
ZPBP2
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for ZPBP2 Antibody
- CAAX prenyl protease 1 homolog
- EC 3.4.24.84
- FACE1FLJ14968
- FACE-1zinc metalloproteinase (STE24 homolog, yeast)
- Farnesylated proteins-converting enzyme 1
- farnesylated-proteins converting enzyme 1
- HGPS
- Hutchinson-Gilford progeria syndrome
- MADB
- Prenyl protein-specific endoprotease 1
- PRO1
- Ste24p
- STE24zinc metallopeptidase (STE24 homolog, yeast)
- zinc metallopeptidase (STE24 homolog, S. cerevisiae)
- Zinc metalloproteinase Ste24 homolog