UHRF1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:RETAVNGQGELIPLKNIEGELSSAIHMTKDATKEALHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLSLP
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
UHRF1
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For HIER pH6 retrieval is recommended.
|
||
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for UHRF1 Antibody
- E3 ubiquitin-protein ligase UHRF1
- EC 6.3.2
- EC 6.3.2.-
- FLJ21925
- hNP95
- huNp95
- ICBP90NP95
- Inverted CCAAT box-binding protein of 90 kDa
- Np95
- Nuclear protein 95
- Nuclear zinc finger protein Np95
- RING finger protein 106
- RNF106MGC138707
- Transcription factor ICBP90
- Ubiquitin-like PHD and RING finger domain-containing protein 1
- ubiquitin-like with PHD and ring finger domains 1
- ubiquitin-like, containing PHD and RING finger domains, 1
- Ubiquitin-like-containing PHD and RING finger domains protein 1