UBL3 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILR
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
UBL3
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for UBL3 Antibody
- DKFZP434K151
- FLJ32018
- HCG-1
- hsMUB
- Membrane-anchored ubiquitin-fold protein
- MUB
- PNSC1
- Protein HCG-1
- ubiquitin-like 3
- ubiquitin-like protein 3