Product: Pseudoginsenoside F12
TSSC3 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to PHLDA2(pleckstrin homology-like domain, family A, member 2) The peptide sequence was selected from the middle region of PHLDA2.Peptide sequence QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
PHLDA2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against PHLDA2 and was validated on Western blot.
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for TSSC3 Antibody
- Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein
- BWR1Cp17-Beckwith-Wiedemann region 1 C
- HLDA2BRW1C
- Imprinted in placenta and liver protein
- IPLp17-BWR1C
- pleckstrin homology-like domain family A member 2
- pleckstrin homology-like domain, family A, member 2
- TSSC3p17-Beckwith-Wiedemann region 1C
- tumor suppressing subchromosomal transferable fragment cDNA 3
- tumor suppressing subtransferable candidate 3
- Tumor-suppressing STF cDNA 3 protein
- Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein
- tumor-supressing STF cDNA 3
Background
This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma