TAF1D Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: ESLKQMNVGEDLENEDFDSRRYKFLDDDGSISPIEESTAEDEDATHLEDNECDIKLAGDSFIVSSEFPVRLSVYLEEEDIT
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
TAF1D
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for TAF1D Antibody
- JOSD3RNA polymerase I-specific TBP-associated factor 41 kDa
- Josephin domain containing 3
- MGC5306
- RAFI41
- TAF(I)41
- TAFI41
- TATA box binding protein (TBP)-associated factor, RNA polymerase I, D, 41kDa
- TATA box-binding protein-associated factor 1D
- TATA box-binding protein-associated factor RNA polymerase I subunit D
- TBP-associated factor 1D
- Transcription initiation factor SL1/TIF-IB subunit D