Skp1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
SKP1
|
Purity |
Affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Affinity purified
|
Alternate Names for Skp1 Antibody
- Cyclin-A/CDK2-associated protein p19
- EMC19p19skp1
- MGC34403
- OCP2OCP-2
- OCP-IIS-phase kinase-associated protein 1A (p19A)
- Organ of Corti protein 2
- Organ of Corti protein II
- p19Acyclin A/CDK2-associated p19
- RNA polymerase II elongation factor-like protein OCP2
- RNA polymerase II elongation factor-like protein
- SKP1Acyclin A/CDK2-associated protein p19
- S-phase kinase-associated protein 1
- TCEB1LSIII
- Transcription elongation factor B