SUCLG2 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids:AADQITKLYNLFLKIDATQVEVNPFGETPEGQVVCFDAKINFDDNAEFRQKDIFAMDDKSENEPIENEAAKYDL
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SUCLG2
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended.
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for SUCLG2 Antibody
- EC 6.2.1
- EC 6.2.1.4
- GBETA
- GTP-specific succinyl-CoA synthetase subunit beta
- mitochondrial
- succinate-CoA ligase, GDP-forming, beta subunit
- succinyl-CoA ligase, GDP-forming, beta chain, mitochondrial
- succinyl-CoA synthetase, beta-G chain