SMCX Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLH
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
KDM5C
|
| Purity |
Affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
||
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS, pH 7.2, containing 40% glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Affinity purified
|
Alternate Names for SMCX Antibody
- DXS1272EMRXJ
- EC 1.14.11
- EC 1.14.11.-
- Histone demethylase JARID1C
- JARID1Clysine-specific demethylase 5C
- Jumonji, AT rich interactive domain 1C (RBP2-like)
- jumonji, AT rich interactive domain 1C
- Jumonji/ARID domain-containing protein 1C
- lysine (K)-specific demethylase 5C
- MRXSJ
- Protein SmcX
- Protein Xe169
- Smcx homolog, X chromosome
- SMCXselected cDNA on X
- Smcy homolog, X-linked (mouse)
- Smcy homolog, X-linked
- XE169JmjC domain-containing protein SMCX