SMARCA6 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
HELLS
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
|
||
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for SMARCA6 Antibody
- EC 3.6.1
- EC 3.6.4.-
- helicase, lymphoid-specific
- LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin
- Nbla10143
- PASGFLJ10339
- Proliferation-associated SNF2-like protein
- SMARCA6lymphoid-specific helicase
- subfamily A, member 6
- SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6