SLC6A15 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
SLC6A15
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
||
Application Notes |
For HIER pH6 retrieval is recommended.
|
||
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS (pH 7.2) and 40% Glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Alternate Names for SLC6A15 Antibody
- B0AT2
- DKFZp761I0921
- FLJ10316
- homolog of rat orphan transporter v7-3
- hv7-3
- MGC87066
- NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73
- orphan transporter v7-3
- SBAT1
- Sodium- and chloride-dependent neurotransmitter transporter NTT73
- sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7
- Sodium-coupled branched-chain amino-acid transporter 1
- solute carrier family 6 (neurotransmitter transporter), member 15
- solute carrier family 6 (neutral amino acid transporter), member 15
- Solute carrier family 6 member 15
- solute carrier family 6, member 15
- Transporter v7-3
- V7-3