Product: N-Acetyl-DL-phenylalanine
SLC38A4 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SLC38A4(solute carrier family 38, member 4) The peptide sequence was selected from the middle region of SLC38A4. Peptide sequence LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC38A4
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SLC38A4 and was validated on Western Blot and immunohistochemistry-P The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
|
| Theoretical MW |
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SLC38A4 Antibody
- Amino acid transporter A3
- ATA3MGC126876
- FLJ10191
- N amino acid transporter 3
- Na(+)-coupled neutral amino acid transporter 4
- NAT3amino acid transporter system A3
- PAAT
- SNAT4
- sodium-coupled neutral amino acid transporter 4
- Solute carrier family 38 member 4
- solute carrier family 38, member 4
- System A amino acid transporter 3
- System N amino acid transporter 3
Background
SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Four alternatively spliced transcript variants encoding the same protein have been found for this gene.