Product: CX-4945 (sodium salt)
SLC25A31 Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids:DTVRRRMMMQSGEAKRQYKGTLDCFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYD
|
| Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
| Isotype |
IgG
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SLC25A31
|
| Purity |
Immunogen affinity purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
||
| Application Notes |
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
|
||
| Control Peptide |
|
Reactivity Notes
Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
| Buffer |
PBS (pH 7.2) and 40% Glycerol
|
| Preservative |
0.02% Sodium Azide
|
| Purity |
Immunogen affinity purified
|
Alternate Names for SLC25A31 Antibody
- AAC4DKFZp434N1235
- adenine nucleotide translocase 4
- Adenine nucleotide translocator 4
- ADP
- ADP/ATP translocase 4
- ANT 4
- ANT4DKFZP434N1235
- ATP carrier protein 4
- SFEC
- SFEC35kDa
- solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 31
- Solute carrier family 25 member 31
- Sperm flagellar energy carrier protein