SHC3 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HPYYNSIPSKMPPPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQIPP
|
Specificity |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
|
Isotype |
IgG
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
SHC3
|
Purity |
Affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
|
Buffer |
PBS, pH 7.2, containing 40% glycerol
|
Preservative |
0.02% Sodium Azide
|
Purity |
Affinity purified
|
Alternate Names for SHC3 Antibody
- Neuronal Shc
- NSHCDKFZp686H1544
- N-Shcsrc homology 2 domain containing transforming protein C3
- Protein Rai
- RAI
- SH2 domain protein C3
- SHC (Src homology 2 domain containing) transforming protein 3
- SHCCFLJ45325
- SHC-transforming protein 3
- SHC-transforming protein C
- src homology 2 domain-containing transforming protein C3
- Src homology 2 domain-containing-transforming protein C3