SERCA2 ATPase Antibody Summary
Immunogen |
Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV.
|
Clonality |
Polyclonal
|
Host |
Rabbit
|
Gene |
ATP2A2
|
Purity |
Immunogen affinity purified
|
Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
Dilutions |
|
|
Application Notes |
This is a rabbit polyclonal antibody against ATP2A2 and was validated on Western blot.
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Theoretical MW |
115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
Buffer |
PBS and 2% Sucrose
|
Preservative |
0.09% Sodium Azide
|
Purity |
Immunogen affinity purified
|
Notes
Alternate Names for SERCA2 ATPase Antibody
- ATP2BFLJ20293
- ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2
- ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
- Calcium pump 2
- Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform
- cardiac Ca2+ ATPase
- DAR
- DD
- EC 3.6.3
- EC 3.6.3.8
- Endoplasmic reticulum class 1/2 Ca(2+) ATPase
- FLJ38063
- MGC45367
- sarcoplasmic/endoplasmic reticulum calcium ATPase 2
- SERCA2DKFZp686P0211
- SR Ca(2+)-ATPase 2