SERCA2 ATPase Antibody

Product: Tubacin

SERCA2 ATPase Antibody Summary

Immunogen
Synthetic peptides corresponding to ATP2A2(ATPase, Ca++ transporting, cardiac muscle, slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV.
Clonality
Polyclonal
Host
Rabbit
Gene
ATP2A2
Purity
Immunogen affinity purified
Innovators Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Learn about the Innovators Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ATP2A2 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Theoretical MW
115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-59203.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SERCA2 ATPase Antibody

  • ATP2BFLJ20293
  • ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2
  • ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
  • Calcium pump 2
  • Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform
  • cardiac Ca2+ ATPase
  • DAR
  • DD
  • EC 3.6.3
  • EC 3.6.3.8
  • Endoplasmic reticulum class 1/2 Ca(2+) ATPase
  • FLJ38063
  • MGC45367
  • sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  • SERCA2DKFZp686P0211
  • SR Ca(2+)-ATPase 2

Background

ATP2A2 is one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in multiple transcript variants encoding different isoforms.This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in regulation of the contraction/relaxation cycle. Mutations in this gene cause Darier-White disease, also known as keratosis follicularis, an autosomal dominant skin disorder characterized by loss of adhesion between epidermal cells and abnormal keratinization. Alternative splicing results in two transcript variants encoding different isoforms.

PMID: 10819905