SAP155 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to SF3B1 (splicing factor 3b, subunit 1, 155kDa) The peptide sequence was selected from the middle region of SF3B1.Peptide sequence LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG.
|
| Specificity |
This product is specific to Subunit or Isofrom: 1.
|
| Clonality |
Polyclonal
|
| Host |
Rabbit
|
| Gene |
SF3B1
|
| Purity |
Protein A purified
|
| Innovators Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovators Reward
|
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against SF3B1 and was validated on Western Blot and immunohistochemistry-p
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles.
|
| Buffer |
PBS and 2% Sucrose
|
| Preservative |
0.09% Sodium Azide
|
| Purity |
Protein A purified
|
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for SAP155 Antibody
- Hsh155
- pre-mRNA processing 10
- pre-mRNA splicing factor SF3b, 155 kDa subunit
- Pre-mRNA-splicing factor SF3b 155 kDa subunit
- Prp10
- PRPF10
- SAP 155
- SAP155splicing factor 3b, subunit 1, 155kD
- SF3B155
- SF3b155PRP10
- spliceosome associated protein 155
- Spliceosome-associated protein 155
- splicing factor 3B subunit 1
- splicing factor 3b, subunit 1, 155kDa
Background
SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the introns branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.